PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo6G0071600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family MYB
Protein Properties Length: 488aa    MW: 53952.9 Da    PI: 8.6286
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo6G0071600genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.65.1e-172066148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT eEde l +avk + g++Wk+Ia+ ++  R++ qc +rwqk+l
   Spipo6G0071600 20 KGGWTLEEDETLREAVKAYKGRCWKKIAEFFP-DRSEVQCLHRWQKVL 66
                     688*****************************.************986 PP

2Myb_DNA-binding62.96.3e-2072118148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT+eEd+++v++vk++G+  W+ Ia+ ++ gR +kqc++rw+++l
   Spipo6G0071600  72 KGPWTPEEDDKIVELVKKYGPTKWSIIAKSLP-GRIGKQCRERWHNHL 118
                      79******************************.*************97 PP

3Myb_DNA-binding58.31.7e-18124167146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +++WT eE+ +l++a++ +G++ W+ Ia+ ++ gRt++++k++w++
   Spipo6G0071600 124 KDAWTLEEEVQLINAHQIHGNK-WAEIAKFLP-GRTDNSIKNHWNS 167
                      679*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.231566IPR017930Myb domain
SuperFamilySSF466895.38E-181780IPR009057Homeodomain-like
SMARTSM007174.0E-151968IPR001005SANT/Myb domain
PfamPF002493.2E-152066IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.5E-182271IPR009057Homeodomain-like
CDDcd001672.63E-132366No hitNo description
PROSITE profilePS5129433.19667122IPR017930Myb domain
SuperFamilySSF466895.24E-3369165IPR009057Homeodomain-like
SMARTSM007171.2E-1871120IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-2772121IPR009057Homeodomain-like
PfamPF002495.5E-1972118IPR001005SANT/Myb domain
CDDcd001672.59E-1674118No hitNo description
Gene3DG3DSA:1.10.10.602.0E-23122173IPR009057Homeodomain-like
PROSITE profilePS5129422.557123173IPR017930Myb domain
SMARTSM007171.3E-17123171IPR001005SANT/Myb domain
PfamPF002499.8E-17124167IPR001005SANT/Myb domain
CDDcd001672.34E-13126169No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 488 aa     Download sequence    Send to blast
AYDYRSLETR RTTGPIRRAK GGWTLEEDET LREAVKAYKG RCWKKIAEFF PDRSEVQCLH  60
RWQKVLNPEL VKGPWTPEED DKIVELVKKY GPTKWSIIAK SLPGRIGKQC RERWHNHLNP  120
LIKKDAWTLE EEVQLINAHQ IHGNKWAEIA KFLPGRTDNS IKNHWNSSLK KKLDLYLATG  180
KLSAASKSVM PKDVGTTASG RLQVCSLQGS EQSPQSSSKA SLLSGPSPSG PLEMEGHKYG  240
LEPTATEFHV EASKNVPVNG VDGSVDINGM WKTQGDDERS CKRSDLGVKS GAHADDMEID  300
YKMGNGTSEY AEDVPRVGSL FYKPPQLETC GVSAASSILN KYCLLQELPN PRYSTPLNAK  360
HAAECSPELI LKNAAKSFPS TPSIIRRRRN RVSTPLSSVE DSGKAGCSPG QAPSSGPFNG  420
NQEGAEEKKN ENFTFSPPYQ VRPVRAPMLR PLEKQLEFTL ESEMSEKNAK SMCSCTSNVS  480
CGSNADAS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C2e-68191735159MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-68191735159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00482DAPTransfer from AT5G02320Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008802730.11e-156PREDICTED: uncharacterized protein LOC103716487 isoform X1
RefseqXP_008802731.11e-156PREDICTED: uncharacterized protein LOC103716487 isoform X1
RefseqXP_008802732.11e-156PREDICTED: uncharacterized protein LOC103716487 isoform X1
TrEMBLB7FM221e-137B7FM22_MEDTR; Putative uncharacterized protein
STRINGGLYMA07G15820.41e-134(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30993880
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02320.21e-113myb domain protein 3r-5